PDB entry 1wz2

View 1wz2 on RCSB PDB site
Description: The crystal structure of Leucyl-tRNA synthetase and tRNA(leucine) complex
Deposited on 2005-02-21, released 2005-09-06
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.241
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: leuS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: leucyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: leuS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tRNA
  • Chain 'D':
    Compound: tRNA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wz2A (A:)
    maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytip
    dviarfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfe
    dpinivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkga
    hrvrwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtn
    mwvnpnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpv
    sgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivenit
    yisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvppyegkpv
    qevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekark
    alermkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayyt
    isrhinklrqegkldpekltpeffdyifleefsedkekelekktgipaeiihemkeefey
    wypldwrcsgkdlipnhltffifnhvaifreehwpkgiavngfgtlegqkmskskgnvln
    fidaieengadvvrlyimslaehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnv
    elkdidrwmlhrlnkaikettnaleefrtrtavqwafysimndlrwylrrtegrddeakr
    yvlrtladvwvrlmapftphiceelweklggegfvslakwpepveewwnetieaeeefir
    svmedikeiievakienakrayiytaedwkwkvaevvsekrdfkssmeelmkdseirkhg
    kevakivqklikertfdvkrineekalreakefmekelgieiiinptedkggkkkqampl
    kpaifie
    

    Sequence, based on observed residues (ATOM records):
    >1wz2A (A:)
    lnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdvi
    arfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpi
    nivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrv
    rwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtnmwv
    npnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpvsgd
    eviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivfpaveev
    nklgiksqkdkekleqatktiykaeyhkgifkvppyegkpvqevkeaiakemlekgiaei
    myefaeknvisrfgnravikiihdqwfidygnpewkekarkalermkilpetrraqfeai
    idwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqegkldpekl
    tpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhlt
    ffifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyims
    laehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaike
    ttnaleefrtrtavqwafysimndlrwylrrtegrddeakryvlrtladvwvrlmapftp
    hiceelweklggegfvslakwpepveewwnetieaeeefirsvmedikeiievakienak
    rayiytaedwkwkvaevvsekrdfkssmeelmkdseirkhgkevakivqklikertfdvk
    rineekalreakefmekelgieiiinptedkggkkkqamplkpaifie
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wz2B (B:)
    maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytip
    dviarfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfe
    dpinivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkga
    hrvrwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtn
    mwvnpnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpv
    sgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivenit
    yisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvppyegkpv
    qevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekark
    alermkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayyt
    isrhinklrqegkldpekltpeffdyifleefsedkekelekktgipaeiihemkeefey
    wypldwrcsgkdlipnhltffifnhvaifreehwpkgiavngfgtlegqkmskskgnvln
    fidaieengadvvrlyimslaehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnv
    elkdidrwmlhrlnkaikettnaleefrtrtavqwafysimndlrwylrrtegrddeakr
    yvlrtladvwvrlmapftphiceelweklggegfvslakwpepveewwnetieaeeefir
    svmedikeiievakienakrayiytaedwkwkvaevvsekrdfkssmeelmkdseirkhg
    kevakivqklikertfdvkrineekalreakefmekelgieiiinptedkggkkkqampl
    kpaifie
    

    Sequence, based on observed residues (ATOM records):
    >1wz2B (B:)
    lnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdvi
    arfkrmqgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpi
    nivkyfmkaaketfiragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrv
    rwdpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtnmwv
    npnatyvkakvrrkdkeetwivskeaayklsfqdreievieefkgekligkyvrnpvsgd
    eviilpaefvdpdnatgvvmsvpahapfdhvaledlkreteilekydidprivfpaveev
    nklgiksqkdkekleqatktiykaeyhkgifkvppyegkpvqevkeaiakemlekgiaei
    myefaeknvisrfgnravikiihdqwfidygnpewkekarkalermkilpetrraqfeai
    idwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqegkldpekl
    tpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhlt
    ffifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyims
    laehdsdfdwrrkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaike
    ttnaleefrtrtavqwafysimndlrwylrrtegrddeakryvlrtladvwvrlmapftp
    hiceelweklggegfvslakwpepveewwnetieaeeefirsvmedikeiievakienak
    rayiytaedwkwkvaevvsekrdfkssmeelmkdseirkhgkevakivqklikertfdvk
    rineekalreakefmekelgieiiinptedkggkkkqamplkpaifie
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.