PDB entry 1wz1
View 1wz1 on RCSB PDB site
Description: Crystal structure of the Fv fragment complexed with dansyl-lysine
Class: immune system
Keywords: Antigen-antibody fragent complex, IMMUNE SYSTEM
Deposited on
2005-02-21, released
2006-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Ig heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1wz1h_ - Chain 'L':
Compound: Ig light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- GB AAB03598 (0-112)
- see remark 999 (16)
- see remark 999 (100)
- see remark 999 (104)
Domains in SCOPe 2.06: d1wz1l_ - Heterogens: DNS
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1wz1H (H:)
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
aep
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1wz1L (L:)
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr