PDB entry 1wz0

View 1wz0 on RCSB PDB site
Description: Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
Class: structural genomics, unknown function
Keywords: SUMO-2, ubiquitin-like molecule, Structural genomics, Sentrin2, NPPFSA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-02-21, released 2005-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-like protein SMT3B
  Species: Homo sapiens [TaxId:9606]
  Gene: SMT3B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61956 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOPe 2.08: d1wz0a1, d1wz0a2, d1wz0a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wz0A (A:)
  gssgssgmadekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqgl
  smrqirfrfdgqpinetdtpaqlemededtidvfqqqtsgpssg