PDB entry 1wyz

View 1wyz on RCSB PDB site
Description: X-Ray structure of the putative methyltransferase from Bacteroides thetaiotaomicron VPI-5482 at the resolution 2.5 A. Norteast Structural Genomics Consortium target Btr28
Class: transferase
Keywords: Northeast Structural Genomics Consortium, BtR28, methyltransferase, PSI, Protein Structure Initiative, NESG, TRANSFERASE
Deposited on 2005-02-21, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative S-adenosylmethionine-dependent methyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A031 (Start-233)
      • modified residues (85)
      • modified residues (128)
      • modified residues (180)
    Domains in SCOPe 2.08: d1wyza1
  • Chain 'B':
    Compound: putative S-adenosylmethionine-dependent methyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A031 (Start-233)
      • modified residues (85)
      • modified residues (128)
      • modified residues (180)
      • expression tag (234)
    Domains in SCOPe 2.08: d1wyzb2, d1wyzb3
  • Chain 'C':
    Compound: putative S-adenosylmethionine-dependent methyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A031 (Start-233)
      • modified residues (85)
      • modified residues (128)
      • modified residues (180)
      • expression tag (234)
    Domains in SCOPe 2.08: d1wyzc2, d1wyzc3
  • Chain 'D':
    Compound: putative S-adenosylmethionine-dependent methyltransferase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A031 (Start-233)
      • modified residues (85)
      • modified residues (128)
      • modified residues (180)
      • expression tag (234)
    Domains in SCOPe 2.08: d1wyzd2, d1wyzd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyzA (A:)
    metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididslt
    fyplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvg
    pssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhk
    miedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyzA (A:)
    etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
    yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
    masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
    crpqtklciaanitcegefiqtrtvkdwkghipkipcifllyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyzB (B:)
    metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididslt
    fyplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvg
    pssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhk
    miedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyzB (B:)
    etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
    yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
    masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
    crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllykl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wyzC (C:)
    metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididslt
    fyplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvg
    pssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhk
    miedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyzC (C:)
    etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
    yplspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsvmasg
    fngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqncrpq
    tklciaanitcegefiqtrtvkdwkghipelskipcifllykl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wyzD (D:)
    metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididslt
    fyplnkhtspedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvg
    pssiilsvmasgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhk
    miedilqncrpqtklciaanitcegefiqtrtvkdwkghipelskipcifllyklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyzD (D:)
    etalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltf
    yplnkhtspedisgylkplaggasmgvisedpgadvvaiaqrqklkviplvgpssiilsv
    masgfngqsfafhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqn
    crpqtklciaanitcegefiqtrtvkdwkghipelskipcifllykl