PDB entry 1wyy

View 1wyy on RCSB PDB site
Description: Post-fusion hairpin conformation of the sars coronavirus spike glycoprotein
Class: viral protein
Keywords: membrane fusion, severe acute respiratory syndrome, viral protein
Deposited on 2005-02-18, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyya1
  • Chain 'B':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyyb1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyyA (A:)
    gsayrfngigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqaln
    tlvkqlssnfgaissvlndilsrldkveaevqidrlitggrggsdvdlgdisginasvvn
    iqkeidrlnevaknlneslidlqelgkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyyA (A:)
    gigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqls
    snfgaissvlndilsrldkveaevlgdisginasvvniqkeidrlnevaknlneslidlq
    elgkye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyyB (B:)
    gsayrfngigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqaln
    tlvkqlssnfgaissvlndilsrldkveaevqidrlitggrggsdvdlgdisginasvvn
    iqkeidrlnevaknlneslidlqelgkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyyB (B:)
    gvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssn
    fgaissvlndilsrldkveaevlgdisginasvvniqkeidrlnevaknlneslidlqel
    gkye