PDB entry 1wyw

View 1wyw on RCSB PDB site
Description: Crystal Structure of SUMO1-conjugated thymine DNA glycosylase
Class: hydrolase
Keywords: Hydrolase
Deposited on 2005-02-17, released 2005-06-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/T mismatch-specific thymine DNA glycosylase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wywa1
  • Chain 'B':
    Compound: Ubiquitin-like protein SMT3C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wywb1
  • Heterogens: CL, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wywA (A:)
    gsngvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsgls
    evqlnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpriavf
    ngkciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyy
    iklkdlrdqlkgiernmdvqevqytfdlqlaqedakkmavkeekydpgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wywA (A:)
    aelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsglsevqlnhm
    ddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpriavfngkciye
    ifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyyiklkdlr
    dqlkgiernmdvqevqytfdlqlaqedakkmavkee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wywB (B:)
    msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
    slrflfegqriadnhtpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wywB (B:)
    geyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
    elgmeeedvievyqeqtgg