PDB entry 1wyt

View 1wyt on RCSB PDB site
Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in apo form
Class: oxidoreductase
Keywords: ALPHA(2)BETA(2) TETRAMER, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2005-02-17, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyta1
  • Chain 'B':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wytb1
  • Chain 'C':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wytc_
  • Chain 'D':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wytd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wytA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wytA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wytB (B:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wytB (B:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wytC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wytC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wytD (D:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wytD (D:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd