PDB entry 1wyr

View 1wyr on RCSB PDB site
Description: Solution structure of the CH domain of human Rho guanine nucleotide exchange factor 6
Class: Structural Protein
Keywords: CH domain, all-alpha, NPPSFA, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Protein
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15052 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.08: d1wyra1, d1wyra2, d1wyra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wyrA (A:)
    gssgssgeeqivtwlislgvlespkkticdpeeflksslkngvvlcklinrlmpgsvekf
    cldpqteadcinnindflkgcatlqveifdpddlysgvnfskvlstllavnkatesgpss
    g