PDB entry 1wyk

View 1wyk on RCSB PDB site
Description:
Deposited on 1998-01-12, released 1998-04-29
The last revision prior to the SCOP 1.65 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1wyka_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1wykb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1wykc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1wykd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wykA (A:)
    xmrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpv
    nmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivl
    ggadegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wykB (B:)
    xmrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpv
    nmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivl
    ggadegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wykC (C:)
    xmrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpv
    nmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivl
    ggadegtrtalsvvtwnskgktikttpegteew
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wykD (D:)
    xmrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpv
    nmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivl
    ggadegtrtalsvvtwnskgktikttpegteew