PDB entry 1wyj

View 1wyj on RCSB PDB site
Description: Solution structure of mouse protocadherin beta 14 (26-137)
Deposited on 2005-02-15, released 2005-08-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocadherin beta 14
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2210006M07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PB90 (7-118)
      • cloning artifact (0-6)
      • cloning artifact (119-124)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wyjA (A:)
    gssgssgagsatitysvleetdrgslvgnlakdlglslrelitrgaqilskgnkqllqle
    qksgnlllkekldreelcgstnpcilhfqvllkspvqfiqgeiqlqdvndhapefmedes
    gpssg