PDB entry 1wyi

View 1wyi on RCSB PDB site
Description: human triosephosphate isomerase of new crystal form
Class: isomerase
Keywords: TIM, microgravity, new crystal form, ISOMERASE
Deposited on 2005-02-14, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyia_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyiA (A:)
    gsapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpk
    iavaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahala
    eglgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatp
    qqaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkp
    efvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyiA (A:)
    apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyiB (B:)
    gsapsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpk
    iavaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahala
    eglgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatp
    qqaqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkp
    efvdiinakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyiB (B:)
    apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
    vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
    aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
    vdiinakq