PDB entry 1wyh

View 1wyh on RCSB PDB site
Description: Solution structure of the LIM domain from human Skeletal muscle LIM-protein 2
Class: metal binding protein
Keywords: LIM, Structural Genomics, NMR, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, METAL BINDING PROTEIN
Deposited on 2005-02-14, released 2005-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Skeletal muscle LIM-protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: SLIM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13643 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOPe 2.07: d1wyha1, d1wyha2, d1wyha3, d1wyha4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wyhA (A:)
  gssgssgcsacgetvmpgsrkleyggqtwhehcflcsgceqplgsrsfvpdkgahycvpc
  yenkfasgpssg