PDB entry 1wyg

View 1wyg on RCSB PDB site
Description: Crystal Structure of a Rat Xanthine Dehydrogenase Triple Mutant (C535A, C992R and C1324S)
Deposited on 2005-02-14, released 2005-05-31
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22985 (Start-1330)
      • engineered (534)
      • engineered (991)
      • engineered (1323)
  • Heterogens: PO4, CA, FES, FAD, SAL, ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wygA (A:)
    mtadelvffvngkkvveknadpettllvylrrklglcgtklgcgeggcgactvmiskydr
    lqnkivhfsvnaclapicslhhvavttvegigntqklhpvqeriarshgsqcgfctpgiv
    msmytllrnqpeptveeienafqgnlcrctgyrpilqgfrtfakdggccggsgnnpnccm
    nqtkdqtvslspslfnpedfkpldptqepifppellrlkdtpqkklrfegervtwiqast
    meelldlkaqhpdaklvvgnteigiemkfknmlfplivcpawipelnsvvhgpegisfga
    scplslvesvlaeeiaklpeqktevfrgvmeqlrwfagkqvksvasiggniitaspisdl
    npvfmasgakltlvsrgtrrtvrmdhtffpgyrktllrpeeillsieipyskegeffsaf
    kqasrreddiakvtsgmrvlfkpgtievqelslcfggmadrtisalkttpkqlskswnee
    llqsvcaglaeelqlapdapggmvefrrtltlsfffkfyltvlqklgradledmagkldp
    tfasatllfqkdppanvqlfqevpkdqseedmvgrplphlaanmqasgeavycddiprye
    nelslrlvtstrahakitsidtseakkvpgfvcfltaedvpnsnatglfndetvfakdev
    tcvghiigavvadtpehaqraargvkityedlpaiitiqdainnnsfygseikiekgdlk
    kgfseadnvvsgelyiggqehfyletnctiavpkgeagemelfvstqntmktqsfvakml
    gvpdnrivvrvkrmgggfggketrstvvstalalaahktgrpvrcmldrdedmlitggrh
    pflakykvgfmktgtvvalevahfsnggntedlsrsimeralfhmdnaykipnirgtgri
    cktnlpsntafrgfggpqgmliaeywmsevaitcglpaeevrrknmykegdlthfnqkle
    gftlprcwdeciassqylarkrevekfnrenrwkkrglciiptkfgisftlpflnqggal
    vhvytdgsvllthggtemgqglhtkmvqvasralkiptskihisetstntvpntsptaas
    asadlngqgvyeacqtilkrlepfkkkkptgpweawvmdaytsavslsatgfyktpnlgy
    sfetnsgnpfhyfsygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftmeelhyspegslhtrgpstykipafgsipiefrvsllrdcpnkraiyaskavg
    epplflassiffaikdairaaraqhgdnakqlfqldspatpekirnacvdqfttlcvtgv
    penskswsvri
    

    Sequence, based on observed residues (ATOM records):
    >1wygA (A:)
    adelvffvngkkvveknadpettllvylrrklglcgtklgcgeggcgactvmiskydrlq
    nkivhfsvnaclapicslhhvavttvegigntqklhpvqeriarshgsqcgfctpgivms
    mytllrnqpeptveeienafqgnlcrctgyrpilqgfrtfakpslfnpedfkpldptqep
    ifppellrlkdtpqkklrfegervtwiqastmeelldlkaqhpdaklvvgnteigiemkf
    knmlfplivcpawipelnsvvhgpegisfgascplslvesvlaeeiaklpeqktevfrgv
    meqlrwfagkqvksvasiggniitaspisdlnpvfmasgakltlvsrgtrrtvrmdhtff
    pgyrktllrpeeillsieipyskegeffsafkqasrreddiakvtsgmrvlfkpgtievq
    elslcfggmadrtisalkttpkqlskswneellqsvcaglaeelqlapdapggmvefrrt
    ltlsfffkfyltvlqklgradledmagkldptfasatllfqkdppanvqlfqevpkdqse
    edmvgrplphlaanmqasgeavycddipryenelslrlvtstrahakitsidtseakkvp
    gfvcfltaedvpnsnatglfndetvfakdevtcvghiigavvadtpehaqraargvkity
    edlpaiitiqdainnnsfygseikiekgdlkkgfseadnvvsgelyiggqehfyletnct
    iavpkgeagemelfvstqntmktqsfvakmlgvpdnrivvrvkrmgggfggketrstvvs
    talalaahktgrpvrcmldrdedmlitggrhpflakykvgfmktgtvvalevahfsnggn
    tedlsrsimeralfhmdnaykipnirgtgricktnlpsntafrgfggpqgmliaeywmse
    vaitcglpaeevrrknmykegdlthfnqklegftlprcwdeciassqylarkrevekfnr
    enrwkkrglciiptkfgisftlpflnqggalvhvytdgsvllthggtemgqglhtkmvqv
    asralkiptskihisetstntvpntsptaasasadlngqgvyeacqtilkrlepfkkkkp
    tgpweawvmdaytsavslsatgfyktpnlgysfetnsgnpfhyfsygvacseveidcltg
    dhknlrtdivmdvgsslnpaidigqvegafvqglglftmeelhyspegslhtrgpstyki
    pafgsipiefrvsllrdcpnkraiyaskavgepplflassiffaikdairaaraqhgdna
    kqlfqldspatpekirnacvdqfttlcvtskswsvri