PDB entry 1wye

View 1wye on RCSB PDB site
Description: Crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from Sulfolobus Tokodaii
Class: transferase
Keywords: archea, Sulfolobus tokokai, TRANSFERASE
Deposited on 2005-02-12, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyea_
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyeb_
  • Chain 'C':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyec_
  • Chain 'D':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyed_
  • Chain 'E':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyee_
  • Chain 'F':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wyef_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyeA (A:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeA (A:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyeB (B:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeB (B:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wyeC (C:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeC (C:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wyeD (D:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeD (D:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wyeE (E:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeE (E:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wyeF (F:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyeF (F:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflremk