PDB entry 1wyd

View 1wyd on RCSB PDB site
Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii
Class: ligase
Keywords: aspartyl-tRNA synthetase, archaea, sulfolobus tokodaii, LIGASE
Deposited on 2005-02-12, released 2006-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical aspartyl-tRNA synthetase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wyda1, d1wyda2
  • Chain 'B':
    Compound: hypothetical aspartyl-tRNA synthetase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wydb1, d1wydb2
  • Heterogens: CL, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wydA (A:)
    myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
    qeltqesviqvrgivkadkraprgielhaeeitllskakaplpldvsgkvkadidtrlre
    rvldlrrqemqavikiqslalkafretlykegfieiftpkiiasateggaqlfpviyfgk
    eaflaqspqlykelmagvvervfevapawraeesdtpfhlaefismdvemafadyndvmq
    llekilhnivktikeegkeelkilnyeppevkipikrlkyteaieilrskgynikfgddi
    gtpelrilneelkedlyfivdwpsdarpfytksksenpelsesfdliykfleivsgstrn
    hkrevleealkkkglkpesfefflkwfdygmpphagfgmglarlmvmltgiqsvkeivpf
    prdkkrltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wydA (A:)
    myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
    qeltqesviqvrgivkadkraprgielhaeeitllskakaplpldvsgkvkadidtrlre
    rvldlrrqemqavikiqslalkafretlykegfieiftpkiiasateggaqlfpviyfgk
    eaflaqspqlykelmagvvervfevapawraeesdtpfhlaefismdvemafadyndvmq
    llekilhnivktikeegkeelkilnyeppevkipikrlkyteaieilrskgynikfgddi
    gtpelrilneelkedlyfivdwpsdarpfytksksepelsesfdliykfleivsgstrnh
    krevleealkkkglkpesfefflkwfdygmpphagfgmglarlmvmltgiqsvkeivpfp
    rdkkrltp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wydB (B:)
    myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
    qeltqesviqvrgivkadkraprgielhaeeitllskakaplpldvsgkvkadidtrlre
    rvldlrrqemqavikiqslalkafretlykegfieiftpkiiasateggaqlfpviyfgk
    eaflaqspqlykelmagvvervfevapawraeesdtpfhlaefismdvemafadyndvmq
    llekilhnivktikeegkeelkilnyeppevkipikrlkyteaieilrskgynikfgddi
    gtpelrilneelkedlyfivdwpsdarpfytksksenpelsesfdliykfleivsgstrn
    hkrevleealkkkglkpesfefflkwfdygmpphagfgmglarlmvmltgiqsvkeivpf
    prdkkrltp