PDB entry 1wyb

View 1wyb on RCSB PDB site
Description: Structure of 6-aminohexanoate-dimer hydrolase
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-02-09, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-aminohexanoate-dimer hydrolase
    Species: Flavobacterium sp. [TaxId:239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07062 (Start-20)
    • GB BAA05089 (21-391)
    Domains in SCOPe 2.07: d1wyba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wybA (A:)
    mnarstgqhparypgaaageptldswqepphnrwafahlgemvpsaavsrrpvnapghal
    arlgaiaaqlpdleqrleqtytdaflvlrgtevvaeyyragfapddrhllmsvskslcgt
    vvgalvdegridpaqpvteyvpelagsvydgpsvlqvldmqisidynedyvdpasevqth
    grsagwrtrrhgdpadtyeflttlrgdgstgefqycsantdvlawivervtglryveals
    tylwakldadrdatitvdttgfgfahggvsctardlarvgrmmldggvapggrvvsedwv
    rrvlaggsheamtdkgftntfpdgsytrqwwctgnergnvsgigihgqnlwldpltdsvi
    vklsswpdpdtehwhrlqngilldvsraldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wybA (A:)
    stgqhparypgaaageptldswqepphnrwafahlgemvpsaavsrrpghalarlgaiaa
    qlpdleqrleqtytdaflvlrgtevvaeyyragfapddrhllmsvskslcgtvvgalvde
    gridpaqpvteyvpelagsvydgpsvlqvldmqisidynesevqthgrsagwrtrrhgdp
    adtyeflttlrgdgstgefqycsantdvlawivervtglryvealstylwakldadrdat
    itvdttgfgfahggvsctardlarvgrmmldggvapggrvvsedwvrrvlaggsheamtd
    kgftntfpdgsytrqwwctgnergnvsgigihgqnlwldpltdsvivklsswpdpdtehw
    hrlqngilldvsraldav