PDB entry 1wy9

View 1wy9 on RCSB PDB site
Description: Crystal structure of microglia-specific protein, Iba1
Deposited on 2005-02-09, released 2006-02-21
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allograft inflammatory factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Aif1, Iba1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wy9A (A:)
    msqsrdlqggkafgllkaqqeerleginkqflddpkysndedlpskleafkvkymefdln
    gngdidimslkrmleklgvpkthlelkrlirevssgseetfsysdflrmmlgkrsailrm
    ilmyeeknkehkrptgppakkaiselp
    

    Sequence, based on observed residues (ATOM records):
    >1wy9A (A:)
    kaqqeerleginkqflddpkysndedlpskleafkvkymefdlngngdidimslkrmlek
    lgvpkthlelkrlirevssgseetfsysdflrmmlgkrsailrmilmyeek