PDB entry 1wy6

View 1wy6 on RCSB PDB site
Description: Crystal Structure of Hypothetical Protein [ST1625p] from Hyperthermophilic Archaeon Sulfolobus tokodaii
Class: structural genomics, unknown function
Keywords: hypothetical protein, helical repeat protein, structural genomics, UNKNOWN FUNCTION
Deposited on 2005-02-07, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ST1625
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wy6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wy6A (A:)
    tivkseiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfq
    vldkigsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilkn
    nevsasilvaianalrrvgderdattllieackkgekeacnavntltvrsvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy6A (A:)
    eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
    gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilnevsasi
    lvaianalrrvgderdattllieackkgekeacnavntl