PDB entry 1wy5

View 1wy5 on RCSB PDB site
Description: Crystal structure of isoluecyl-tRNA lysidine synthetase
Class: translation
Keywords: N-type ATP-PPase, STRUCTURAL GENOMICS, TRANSLATION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-02-06, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0072 protein AQ_1887
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wy5a1, d1wy5a2
  • Chain 'B':
    Compound: Hypothetical UPF0072 protein AQ_1887
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wy5b1, d1wy5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wy5A (A:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy5A (A:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wy5B (B:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy5B (B:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwl