PDB entry 1wy3

View 1wy3 on RCSB PDB site
Description: chicken villin subdomain hp-35, k65(nle), n68h, ph7.0
Deposited on 2005-02-04, released 2005-05-03
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 0.9500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: villin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (0-34)
      • engineered (23)
      • engineered (26)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wy3A (A:)
    lsdedfkavfgmtrsafanlplwlqqhlkkekglf