PDB entry 1wy2

View 1wy2 on RCSB PDB site
Description: Crystal Structure of the Prolidase from Pyrococcus horikoshii OT3
Deposited on 2005-02-04, released 2005-02-22
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xaa-Pro Dipeptidase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Xaa-Pro Dipeptidase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CAC, ZN, MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wy2A (A:)
    mdimnekvkkiiefmdknsidavliaknpnvyyisgasplaggyilitgesatlyvpele
    yemakeesnipvekfkkmdefykalegikslgiesslpygfieelkkkanikefkkvddv
    irdmriiksekeikiiekaceiadkavmaaieeitegkkerevaakveylmkmngaekpa
    fdtiiasgyrsalphgvasdkriergdlvvidlgalyqhynsditrtivvgspnekqkei
    yeivleaqkkavesakpgitakeldsiarniiaeygygeyfnhslghgvglevhewprvs
    qydetvlregmvitiepgiyipkiggvriedtilitkngskrltktereli
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wy2B (B:)
    mdimnekvkkiiefmdknsidavliaknpnvyyisgasplaggyilitgesatlyvpele
    yemakeesnipvekfkkmdefykalegikslgiesslpygfieelkkkanikefkkvddv
    irdmriiksekeikiiekaceiadkavmaaieeitegkkerevaakveylmkmngaekpa
    fdtiiasgyrsalphgvasdkriergdlvvidlgalyqhynsditrtivvgspnekqkei
    yeivleaqkkavesakpgitakeldsiarniiaeygygeyfnhslghgvglevhewprvs
    qydetvlregmvitiepgiyipkiggvriedtilitkngskrltktereli
    

    Sequence, based on observed residues (ATOM records):
    >1wy2B (B:)
    nekvkkiiefmdknsidavliaknpnvyyisgasplaggyilitgesatlyvpeleyema
    keesnipvekfkkmdefykalegikslgiesslpygfieelkkkanikefkkvddvirdm
    riiksekeikiiekaceiadkavmaaieeitegkkerevaakveylmkmngaekpafdti
    iasgyrsalphgvasdkriergdlvvidlgalyqhynsditrtivvgspnekqkeiyeiv
    leaqkkavesakpgitakeldsiarniiaeygygeyfnhslghgvglevhewprvsqyde
    tvlregmvitiepgiyipkiggvriedtilitkngskrltktereli