PDB entry 1wy0

View 1wy0 on RCSB PDB site
Description: Crystal structure of geranylgeranyl pyrophosphate synthetase from Pyrococcus horikoshii Ot3
Deposited on 2005-02-03, released 2006-02-14
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB NP_142981
  • Heterogens: HG, BR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wy0A (A:)
    mekyeelfarikekaklidekifelipekdprvlyeaarhyplaggkrvrpfvvltstea
    vggdplraiypavaielihnyslvhddimdmdetrrgkptvhriwgvnmailagdllfsk
    afeavaraeippekkarvlevivkasnelcegqardlefekkstvtieeymemisgktga
    lfeasakvggiigtdneeyikalsswgrnvgiafqiwddvldliadekklgkpvgsdirk
    gkktlivahffenadekdkqrflkifgkyagdvkgrgiieediksdvmeaidllkkygsi
    dyaaeiakdmikkanealrilpkskarmdlellakfiverey
    

    Sequence, based on observed residues (ATOM records):
    >1wy0A (A:)
    ekyeelfarikekaklidekifelipekdprvlyeaarhyplaggkrvrpfvvltsteav
    ggdplraiypavaielihnyslvhddimdmdetrrgkptvhriwgvnmailagdllfska
    feavaraeippekkarvlevivkasnelcegqardlefekkstvtieeymemisgktgal
    feasakvggiigtdneeyikalsswgrnvgiafqiwddvldliadekklgkpvgsdirkg
    kktlivahffenadekdkqrflkifgkdiksdvmeaidllkkygsidyaaeiakdmikka
    nealrilpkskarmdlellakfivere