PDB entry 1wxw

View 1wxw on RCSB PDB site
Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
Class: transferase
Keywords: Thermus thermophillus, methyltransferase, Adomet, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-02-02, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.07: d1wxwa1, d1wxwa2
  • Chain 'B':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.07: d1wxwb1, d1wxwb2
  • Chain 'C':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.07: d1wxwc1, d1wxwc2
  • Chain 'D':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.07: d1wxwd1, d1wxwd2
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxwA (A:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxwA (A:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlraayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaealr
    raeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayrayk
    evnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpvl
    lnhpethylkfavfqvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxwB (B:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxwC (C:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxwD (D:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl