PDB entry 1wxv

View 1wxv on RCSB PDB site
Description: Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
Class: apoptosis
Keywords: structural genomics, apoptosis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-02-02, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bag-family molecular chaperone regulator-1
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.08: d1wxva1, d1wxva2, d1wxva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wxvA (A:)
gssgssgltvtvthsnekhdlhvtsqqgssepvvqdlaqvveevigvpqsfqklifkgks
lkemetplsalgiqdgcrvmligkknsgpssg