PDB entry 1wxt

View 1wxt on RCSB PDB site
Description: Solution structure of the SH3 domain of human hypothetical protein FLJ21522
Class: structural genomics, unknown function
Keywords: SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2005-02-01, released 2005-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein FLJ21522
    Species: Homo sapiens [TaxId:9606]
    Gene: Human cDNA COL05884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T8Q6 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.06: d1wxta1, d1wxta2, d1wxta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxtA (A:)
    gssgssglkmqvlyefearnpreltvvqgeklevldhskrwwlvkneagrsgyipsnile
    plsgpssg