PDB entry 1wxs

View 1wxs on RCSB PDB site
Description: Solution Structure of Ufm1, a ubiquitin-fold modifier
Class: structural genomics, unknown function
Keywords: ubiquitin-fold
Deposited on 2005-02-01, released 2006-04-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-fold Modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61960 (5-End)
      • cloning artifact (0-4)
    Domains in SCOP 1.75: d1wxsa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wxsA (A:)
gplgsmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgi
ginpaqtagnvflkhgselriiprdrvgsc

    Sequence, based on observed residues (ATOM records): (download) 
    >1wxsA (A:)
gplgsmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgi
ginpaqtagnvflkhgselriiprdrvg