PDB entry 1wxr

View 1wxr on RCSB PDB site
Description: Crystal structure of Heme Binding protein, an autotransporter hemoglobine protease from pathogenic Escherichia coli
Deposited on 2005-01-31, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemoglobin protease
    Species: Escherichia coli [TaxId:562]
    Gene: HBP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wxrA (A:)
    gtvnnelgyqlfrdfaenkgmfrpgatniaiynkqgefvgtldkaampdfsavdseigva
    tlinpqyiasvkhnggytnvsfgdgenrynivdrnnapsldfhaprldklvtevaptavt
    aqgavagayldkerypvfyrlgsgtqyikdsngqltkmggayswltggtvgslssyqnge
    mistssglvfdyklngampiygeagdsgsplfafdtvqnkwvlvgvltagngaggrgnnw
    avipldfigqkfnedndapvtfrtseggalewsfnsstgagaltqgtttyamhgqqgndl
    nagknlifqgqngqinlkdsvsqgagsltfrdnytvttsngstwtgagivvdngvsvnwq
    vngvkgdnlhkigegtltvqgtginegglkvgdgkvvlnqqadnkgqvqafssvniasgr
    ptvvltderqvnpdtvswgyrggtldvngnsltfhqlkaadygavlannvdkratitldy
    alradkvalngwsesgkgtagnlykynnpytnttdyfilkqstygyfptdqssnatwefv
    ghsqgdaqklvadrfntagylfhgqlkgnlnvdnrlpegvtgalvmdgaadisgtftqen
    grltlqghpvihayntqsvadklaasgdhsvltqptsfsqedwenrsftfdrlslkntdf
    glgrnatlnttiqadnssvtlgdsrvfidkndgqgtaftleegtsvatkdadksvfngtv
    nldnqsvlnindifnggiqannstvnissdsavlgnstltstalnlnkganalasqsfvs
    dgpvnisdatlslnsrpdevshtllpvydyagswnlkgddarlnvgpysmlsgninvqdk
    gtvtlggegelspdltlqnqmlyslfngyrniwsgslnapdatvsmtdtqwsmngnstag
    nmklnrtivgfnggtspfttlttdnldavqsafvmrtdlnkadklvinksatghdnsiwv
    nflkkpsnkdtldiplvsapeatadnlfrastrvvgfsdvtpilsvrkedgkkewvldgy
    qvarndgqgkaaatfmhisynnfitevn
    

    Sequence, based on observed residues (ATOM records):
    >1wxrA (A:)
    gtvnnelgyqlfrdfaenkgmfrpgatniaiynkqgefvgtldkaampdfsavdseigva
    tlinpqyiasvkhnggytnvsfgdgenrynivdrnnapsldfhaprldklvtevaptavt
    aqgavagayldkerypvfyrlgsgtqyikdsngqltkmggayswltggtvgslssyqnge
    mistssglvfdyklngampiygeagdsgsplfafdtvqnkwvlvgvltagngaggrgnnw
    avipldfigqkfnedndapvtfrtseggalewsfnsstgagaltqgtttyamhgqqgndl
    nagknlifqgqngqinlkdsvsqgagsltfrdnytvttsngstwtgagivvdngvsvnwq
    vngvkgdnlhkigegtltvqgtginegglkvgdgkvvlnqqadnkgqvqafssvniasgr
    ptvvltderqvnpdtvswgyrggtldvngnsltfhqlkaadygavlannvdkratitldy
    alradkvalngwsesgkgtagnlykynnpytnttdyfilkqstygyfptdqssnatwefv
    ghsqgdaqklvadrfntagylfhgqlkgnlnvdnrlpegvtgalvmdgaadisgtftqen
    grltlqghpvihayntqsvadklaasgdhsvltqptsfsqedwenrsftfdrlslkntdf
    glgrnatlnttiqadnssvtlgdsrvfidkndgqgtaftleegtsvatkdadksvfngtv
    nldnqsvlnindifnggiqannstvnissdsavlgnstltstalnlnkganalasqsfvs
    dgpvnisdatlslnsrpdevshtllpvydyagswnlkgddarlnvgpysmlsgninvqdk
    gtvtlggegelspdltlqnqmlyslfngyrniwsgslnapdatvsmtdtqwsmngnstag
    nmklnrtivgfngfttlttdnldavqsafvmrtkadklvinksatghdnsiwvnflkkps
    nkdtldiplvsapeatadnlfrastrvvgfsdvtpilsvrkedgkkewvldgyqvaraaa
    tfmhisynnfitevn