PDB entry 1wxq

View 1wxq on RCSB PDB site
Description: Crystal Structure of GTP binding protein from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: GTP-binding protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2005-01-29, released 2006-04-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.266
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58261 (0-End)
      • modified residue (0)
      • modified residue (74)
      • modified residue (100)
      • modified residue (185)
      • modified residue (216)
      • modified residue (289)
      • modified residue (344)
    Domains in SCOPe 2.01: d1wxqa1, d1wxqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxqA (A:)
    meigvvgkpnvgkstffsaatlvdveianypfttieanvgvtyaitdhpckelgcspnpq
    nyeyrnglalipvkmvdvaglvpgahegrglgnkflddlrmasalihvvdatgktdpegq
    ptdyhdpvedieflereidywiygilskgwdkfakriklqkiklesaiaehlsgigvnen
    dvweamhklnlpedptkwsqddllafaseirrvnkpmviaankadaasdeqikrlvreee
    krgyiviptsaaaeltlrkaakagfieyipgasefkvlrdmsekqkralmvikekvldrf
    gstgvqevinrvvfdllklipvypvhdenkltdqfgnvlphvflmkkgstprdlafkvht
    dlgkgflyainartkrrvgedyelqfndivkivsvtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxqA (A:)
    meigvvgkpnvgkstffsaatlanvgvtyaitdhpckelgcspnpqnyeyrnglalipvk
    mvdvaflddlrmasalihvvdatgktdpegqptdyhdpvedieflereidywiygilskg
    wdkfakriklqkiklesaiaehlsgigvnendvweamhklnlpedptkwsqddllafase
    irrvnkpmviaankadaasdeqikrlvreeekrgyiviptsaaaeltlrkaakagfieyi
    palmvikekvldrfgstgvqevinrvvfdllklipvypvhdeqfgnvlphvflmkkgstp
    rdlafkvhtdlgkgflyainartkrrvgedyelqfndivkivsv