PDB entry 1wxp

View 1wxp on RCSB PDB site
Description: Solution structure of the death domain of nuclear matrix protein p84
Deposited on 2005-01-28, released 2005-07-28
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THO complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: THOC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FV9 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wxpA (A:)
    gssgssgpdvrrdkpvtgeqievfanklgeqwkilapylemkdseirqiecdsedmkmra
    kqllvawqdqegvhatpenlinalnksglsdlaesltndnetnssgpssg