PDB entry 1wxo

View 1wxo on RCSB PDB site
Description: Structure of Archaeal Trans-Editing Protein AlaX in complex with zinc
Class: hydrolase
Keywords: HYDROLASE, Trans-editing
Deposited on 2005-01-27, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0574
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wxoa_
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0574
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wxob_
  • Chain 'C':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0574
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wxoc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxoA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxoA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfelle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wxoB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxoB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wxoC (C:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxoC (C:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfelle