PDB entry 1wxn

View 1wxn on RCSB PDB site
Description: Solution structure of APETx2, a specific peptide inhibitor of ASIC3 proton-gated channels
Deposited on 2005-01-27, released 2005-08-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin APETx2
    Species: Anthopleura elegantissima [TaxId:6110]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wxnA (A:)
    gtacscgnskgiywfyrpscptdrgytgscryflgtcctpad