PDB entry 1wxl

View 1wxl on RCSB PDB site
Description: Solution Structure of the HMG-box domain in the SSRP1 subunit of FACT
Class: DNA binding protein
Keywords: fact, ssrp1, hmg, DNA binding protein
Deposited on 2005-01-26, released 2005-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Single-strand recognition protein
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05344 (3-72)
    • cloning artifact (0-2)
  Domains in SCOPe 2.08: d1wxla1, d1wxla2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wxlA (A:)
  shmpkrattafmlwlndtresikrenpgikvteiakkggemwkelkdkskwedaaakdkq
  ryhdemrnykpea