PDB entry 1wxj

View 1wxj on RCSB PDB site
Description: Crystal Structure Of Tryptophan Synthase A-Subunit with Indole-3-propanol phosphate From Thermus Thermophilus Hb8
Class: lyase
Keywords: structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2005-01-24, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wxja_
  • Heterogens: SO4, IPL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxjA (A:)
    mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgp
    viqraselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqaga
    tgvilpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvtgvt
    gmrerlpeevkdlvrrikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegr
    slapllqeirqglqrleanpglkesskkplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxjA (A:)
    mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysgpviqra
    selalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvil
    pdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsevkdlvrrik
    artalpvavgfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrle