PDB entry 1wxe

View 1wxe on RCSB PDB site
Description: E.coli NAD Synthetase, AMP
Class: Ligase
Keywords: NADE, NAD, E.coli, Ligase
Deposited on 2005-01-23, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wxea1
  • Heterogens: MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxeA (A:)
    mtlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklc
    qmainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseq
    alreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtd
    inplyrlnkrqgkqllaalacpehlykkaptadleddrpslpdevalgvtydniddyleg
    knvpqqvartienwylktehkrrppitvfddfwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxeA (A:)
    tlqqqiikalgakpqinaeeeirrsvdflksylqtypfikslvlgisggqdstlagklcq
    mainelrletgneslqfiavrlpygvqadeqdcqdaiafiqpdrvltvnikgavlaseqa
    lreagielsdfvrgnekarermkaqysiagmtsgvvvgtdhaaeaitgfftkygdggtdi
    nplyrlnkrqgkqllaalacpehlykevalgvtydniddylegknvpqqvartienwylk
    tehkrrppitvfddfwkk