PDB entry 1wxd

View 1wxd on RCSB PDB site
Description: Crystal Structure of Shikimate 5-Dehydrogenase (AroE) from Thermus Thermophilus HB8
Deposited on 2005-01-21, released 2005-02-01
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate 5-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: aroE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Shikimate 5-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: aroE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wxdA (A:)
    mlrfavlghpvahslspamhafaleslglegsyeawdtplealpgrlkevrrafrgvnlt
    lplkeaalahldwvspeaqrigavntvlqvegrlfgfntdapgflealkaggiplkgpal
    vlgaggagravafalreaglevwvwnrtpqralalaeefglravplekarearllvnatr
    vgledpsasplpaelfpeegaavdlvyrplwtrflreakakglkvqtglpmlawqgalaf
    rlwtgllpdpsgmeeaarralgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wxdB (B:)
    mlrfavlghpvahslspamhafaleslglegsyeawdtplealpgrlkevrrafrgvnlt
    lplkeaalahldwvspeaqrigavntvlqvegrlfgfntdapgflealkaggiplkgpal
    vlgaggagravafalreaglevwvwnrtpqralalaeefglravplekarearllvnatr
    vgledpsasplpaelfpeegaavdlvyrplwtrflreakakglkvqtglpmlawqgalaf
    rlwtgllpdpsgmeeaarralgv