PDB entry 1wxb

View 1wxb on RCSB PDB site
Description: Solution structure of the SH3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
Class: Structural genomics, unknown function
Keywords: SH3, EPS8, EPS8L2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor pathway substrate 8-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: EPS8L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WYW7 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.08: d1wxba1, d1wxba2, d1wxba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxbA (A:)
    gssgssgkyvkilydftarnanelsvlkdevlevledgrqwwklrsrsgqagyvpcnilg
    easgpssg