PDB entry 1wxa

View 1wxa on RCSB PDB site
Description: Solution Structure of Ras-binding Domain in Mouse AF-6 Protein
Class: cell adhesion
Keywords: Ras-binding domain, ubiquitin-like fold, AF-6 protein, Structural genomics, Afadin, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Afadin
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4932441D06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZQ1 (7-109)
      • cloning artifact (0-6)
      • cloning artifact (110-115)
    Domains in SCOPe 2.06: d1wxaa1, d1wxaa2, d1wxaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wxaA (A:)
gssgssgsggtlriyadslkpnipyktillsttdtadfavaeslekyglekenpkdycia
rvmlppgaqhsdergakeiildddecplqifrewpsdkgilvfqlkrrppsgpssg