PDB entry 1wx9

View 1wx9 on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in the Human BAT3 Protein
Class: structural genomics, unknown function
Keywords: ubiquitin-like domain, BAT3 protein, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA-B associated transcript-3 isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: BAT3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5STX1 (7-79)
      • cloning artifact (0-6)
      • cloning artifact (80-85)
    Domains in SCOPe 2.03: d1wx9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wx9A (A:)
    gssgssglevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqdd
    kklqeynvggkvihlverapsgpssg