PDB entry 1wx8

View 1wx8 on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
Class: structural genomics, unknown function
Keywords: Ubiquitin-like domain, Ubiquilin 1-like, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 4931431F19
  Species: Mus musculus [TaxId:10090]
  Gene: Riken cDNA 4931431F19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D4I8 (7-89)
    • cloning artifact (0-6)
    • cloning artifact (90-95)
  Domains in SCOPe 2.08: d1wx8a1, d1wx8a2, d1wx8a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wx8A (A:)
  gssgssgvsgrepssriirvsvktpqdchefflaensnvrrfkkqiskylhcnadrlvli
  ftgkilrdqdilsqrgildgstvhvvvrshsgpssg