PDB entry 1wx6

View 1wx6 on RCSB PDB site
Description: Solution structure of the SH3 domain of the human cytoplasmic protein NCK2
Deposited on 2005-01-20, released 2005-07-20
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic protein NCK2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43639 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wx6A (A:)
    gssgssglsngqgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkckna
    rgqvglvpknyvvvlsdgpalhpahsgpssg