PDB entry 1wx4

View 1wx4 on RCSB PDB site
Description: Crystal structure of the oxy-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein prepared by the addition of dithiothreitol
Class: oxidoreductase/metal transport
Keywords: tyrosinase, binary complex, type-3 copper, dioxygen, OXIDOREDUCTASE-METAL TRANSPORT COMPLEX
Deposited on 2005-01-19, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: TYRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx4a1, d1wx4a2
  • Chain 'B':
    Compound: MelC
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: ORF378
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx4b_
  • Heterogens: CU, NO3, PER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wx4A (A:)
    mtvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsfl
    pwhrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpf
    aastgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnh
    legwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptgg
    tpdvvdlnetmkpwntvrpadlldhtayytfdalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx4A (A:)
    tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
    whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
    astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
    egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
    pdvvdlnetmkpwntvrpadlldhtayytfdal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wx4B (B:)
    mpeitrrraltaaaavaatasaavtlaapaasaaghhepaapesfdevykgrriqgrpar
    gaahhhehgggyevfvdgvqlhvmrnadgswisvvshydpvptpraaaraavdelqgapl
    lpfpanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx4B (B:)
    aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
    avdelqgapll