PDB entry 1wx1

View 1wx1 on RCSB PDB site
Description: Crystal structure of nictinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase from Thermus thermophilus HB8
Class: transferase
Keywords: structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wx1a_
  • Chain 'B':
    Compound: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wx1b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wx1A (A:)
    mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
    egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
    gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
    lppeavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiyleg
    yeaglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldl
    algegtgavlampllraaarilhmatfqeagvsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx1A (A:)
    mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
    egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
    gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
    lppeavvggeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiylegyeagl
    plvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldlalgeg
    tgavlampllraaarilhmatfqeagvsrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wx1B (B:)
    mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
    egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
    gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
    lppeavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiyleg
    yeaglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldl
    algegtgavlampllraaarilhmatfqeagvsrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx1B (B:)
    mdpevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvva
    egvsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrp
    gtanlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallg
    lppeavvggeeglrrkrqavaralarlhpgmgplevaaevgglelvaiagiylegyeagl
    plvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldlalgeg
    tgavlampllraaarilhmatfqeagvsrg