PDB entry 1wx0

View 1wx0 on RCSB PDB site
Description: Crystal structure of transaldolase from Thermus thermophilus HB8
Class: transferase
Keywords: structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0a1
  • Chain 'B':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0b_
  • Chain 'C':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0c_
  • Chain 'D':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0d_
  • Chain 'E':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0e_
  • Chain 'F':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0f_
  • Chain 'G':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0g_
  • Chain 'H':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0h_
  • Chain 'I':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0i_
  • Chain 'J':
    Compound: Transaldolase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wx0j_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wx0A (A:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0A (A:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wx0B (B:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0B (B:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wx0C (C:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0C (C:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wx0D (D:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0D (D:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wx0E (E:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0E (E:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wx0F (F:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0F (F:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wx0G (G:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0G (G:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wx0H (H:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0H (H:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1wx0I (I:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0I (I:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1wx0J (J:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdiglkrfledwekvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wx0J (J:)
    melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
    gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
    anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
    teaallgadiatmphavfkqllkhpltdigl