PDB entry 1wwz

View 1wwz on RCSB PDB site
Description: Crystal structure of PH1933 from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: structural genomics, Pyrococcus horikoshii OT3, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1933
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwza1
  • Chain 'B':
    Compound: hypothetical protein PH1933
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwzb1
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wwzA (A:)
    mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffva
    kvgdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndt
    ielwvgeknygamnlyekfgfkkvgksgiwvrmikrqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwzA (A:)
    mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffva
    kvgdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndt
    ielwvgeknygamnlyekfgfkkvgksgiwvrmikrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wwzB (B:)
    mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffva
    kvgdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndt
    ielwvgeknygamnlyekfgfkkvgksgiwvrmikrqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwzB (B:)
    eikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffvakv
    gdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndtie
    lwvgeknygamnlyekfgfkkvgksgiwvrmikrqnl