PDB entry 1wwy

View 1wwy on RCSB PDB site
Description: Solution structure of the DUF1000 domain of a thioredoxin-like protein 1
Deposited on 2005-01-18, released 2005-07-18
The last revision was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TXNL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43396 (7-164)
      • cloning artifact (0-6)
      • cloning artifact (165-170)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wwyA (A:)
    gssgssggymdlmpfinkagceclnesdehgfdnclrkdttflesdcdeqllitvafnqp
    vklysmkfqgpdngqgpkyvkifinlprsmdfeeaerseptqalelteddikedgivplr
    yvkfqnvnsvtifvqsnqgeeettrisyftfigtpvqatnmndfksgpssg