PDB entry 1wwx

View 1wwx on RCSB PDB site
Description: Solution structure of the ETS-domain of the Ets domain transcription factor
Class: DNA binding protein
Keywords: DNA binding, transcriptional activation and repression, E74-like factor 5, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-01-18, released 2005-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E74-like factor 5 ESE-2b
    Species: Homo sapiens [TaxId:9606]
    Gene: ELF5
    Database cross-references and differences (RAF-indexed):
    • GB NP_001413 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.06: d1wwxa1, d1wwxa2, d1wwxa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwxA (A:)
gssgssgsshlwefvrdlllspeencgilewedreqgifrvvksealakmwgqrkkndrm
tyeklsralryyyktgilervdrrlvykfgknahgwqedklsgpssg