PDB entry 1wwv

View 1wwv on RCSB PDB site
Description: Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
Class: transcription
Keywords: structural genomics, kinase suppressor, protein regulation, transcription, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-18, released 2005-07-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Connector enhancer of kinase suppressor of ras 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNKSR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969H4 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOPe 2.01: d1wwva1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwvA (A:)
    gssgssgmepvetwtpgkvatwlrglddslqdypfedwqlpgknllqlcpqslealavrs
    lghqelilggveqlqalssrlqtensgpssg