PDB entry 1wwt

View 1wwt on RCSB PDB site
Description: Solution structure of the TGS domain from human threonyl-tRNA synthetase
Deposited on 2005-01-18, released 2005-07-18
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonyl-tRNA synthetase, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: thrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26639 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wwtA (A:)
    gssgssgdskpikvtlpdgkqvdaeswkttpyqiacgisqgladntviakvnnvvwdldr
    pleedctlellkfedeeaqavysgpssg