PDB entry 1wwr

View 1wwr on RCSB PDB site
Description: Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus
Class: hydrolase
Keywords: homodimer, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2005-01-12, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA adenosine deaminase TadA
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67050 (20-170)
      • expression tag (17-19)
    Domains in SCOPe 2.07: d1wwra1, d1wwra2
  • Chain 'B':
    Compound: tRNA adenosine deaminase TadA
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67050 (20-End)
      • expression tag (12-19)
    Domains in SCOPe 2.07: d1wwrb2, d1wwrb3
  • Chain 'C':
    Compound: tRNA adenosine deaminase TadA
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67050 (20-170)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d1wwrc2, d1wwrc3
  • Chain 'D':
    Compound: tRNA adenosine deaminase TadA
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwrd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wwrA (A:)
    mgsshhhhhhssglvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskah
    nsveelkdptahaemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifs
    aldkkhggvvsvfnildeptlnhrvkweyypleeasellseffkklrnnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwrA (A:)
    gshmgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemla
    ikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnild
    eptlnhrvkweyypleeasellseffkklrnnii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wwrB (B:)
    mgsshhhhhhssglvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskah
    nsveelkdptahaemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifs
    aldkkhggvvsvfnildeptlnhrvkweyypleeasellseffkklrnnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwrB (B:)
    glvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptah
    aemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsv
    fnildeptlnhrvkweyypleeasellseffkklrnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wwrC (C:)
    mgsshhhhhhssglvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskah
    nsveelkdptahaemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifs
    aldkkhggvvsvfnildeptlnhrvkweyypleeasellseffkklrnnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwrC (C:)
    sglvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdpta
    haemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvs
    vfnildeptlnhrvkweyypleeasellseffkklrnnii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wwrD (D:)
    mgsshhhhhhssglvprgshmgkeyflkvalreakrafekgevpvgaiivkegeiiskah
    nsveelkdptahaemlaikeacrrlntkylegcelyvtlepcimcsyalvlsriekvifs
    aldkkhggvvsvfnildeptlnhrvkweyypleeasellseffkklrnnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwrD (D:)
    mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike
    acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept
    lnhrvkweyypleeasellseffkklrnnii