PDB entry 1wwq

View 1wwq on RCSB PDB site
Description: Solution Structure of Mouse ER
Class: cell cycle
Keywords: structural genomics, regulation of cell cycle, ER, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-12, released 2006-01-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Enhancer of rudimentary homolog
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA ZXB00024C14
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84089 (7-110)
    • cloning artifact (0-6)
  Domains in SCOPe 2.08: d1wwqa1, d1wwqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wwqA (A:)
  gsegaatmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsityd
  isqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk